If you have been reading about reversed-phase HPLC and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-04-10. Numbers and descriptions here follow the published literature rather than marketing material.
The peer-reviewed record is dominated by small early-phase studies, case reports and pharmacovigilance summaries rather than large randomised trials. Papers typically examine tanning response, receptor selectivity or patterns of reported adverse events. Many note that participants obtained the peptide outside a clinical setting, which limits verification of composition and administered amount. Reported events vary widely, and causality is frequently unclear because the identity and purity of self-sourced material are unknown. Open questions include whether repeated melanocortin receptor stimulation produces cumulative effects, and how often label claims match actual content.
Identification in laboratories relies on reversed-phase liquid chromatography coupled with tandem mass spectrometry, with product-ion spectra compared against a certified reference standard. High-resolution mass spectrometry supplies accurate mass confirmation, and peptide mapping after enzymatic digestion separates melanotan II from closely related analogues. Quantitation of seized material is complicated by unknown counter-ions and residual trifluoroacetate left from purification. Immunoassays raised against alpha-melanocyte-stimulating hormone can cross-react, so chromatographic confirmation is normally required. Urinary detection windows are short, and reported limits of detection differ substantially between laboratories.
Melanotan II holds no marketing authorisation from the Food and Drug Administration, the European Medicines Agency, the UK Medicines and Healthcare products Regulatory Agency or Australia's Therapeutic Goods Administration. Products sold under that name are treated as unapproved new drugs, and their sale or import is prohibited in several jurisdictions. Other countries classify the peptide as a prescription-only medicine or place it among controlled substances, so the legal position changes with the destination market. No pharmacopoeial monograph supplies an official specification, because the material is not a licensed pharmaceutical. Consequently, products offered online are not manufactured to a shared public standard.
Melanotan II is a synthetic peptide analog modeled on alpha-melanocyte-stimulating hormone, a naturally occurring signaling peptide involved in pigmentation. Its structure is a cyclic heptapeptide containing two non-natural substitutions, norleucine at position four and D-phenylalanine at position seven. These modifications resist enzymatic breakdown and extend the molecule's activity relative to the native hormone. The compound binds melanocortin receptors and is studied mainly as a pharmacological tool rather than a therapeutic product. It has never received approval as a medicine in any major jurisdiction.
The compound was developed in the late 1980s and 1990s by academic researchers investigating photoprotection. The rationale held that stimulating melanin production might reduce ultraviolet damage to skin and lower skin cancer risk. Early work examined receptor binding, pigment response, and short-term tolerability in small studies. That program did not produce an approved drug, and formal development stalled after early-phase trials. Whether induced pigmentation confers meaningful photoprotection remains an open question.
Outside regulated medicine, melanotan II circulates through online vendors as a research chemical, often marketed for tanning. Products sold this way vary widely in purity, concentration, and labeling accuracy, and independent testing has documented discrepancies. Published reports describe both pigment effects and adverse reactions, including nausea, flushing, and darkening of existing moles. Long-term safety data are sparse, and no large controlled trial has established a risk profile. Questions about cumulative effects on melanocytes remain unresolved in the literature.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Unapproved in the US, EU and Australia | Sale and import restricted; no licensed product |
| Typical test matrices | Urine, serum, seized powder | Urinary detection window is short |
| Primary identification method | LC-MS/MS against a reference standard | High-resolution mass used for confirmation |
| Data sources in the literature | Small trials, case reports, pharmacovigilance | No registrational trial dataset exists |
| Common marketing names | Melanotan 2, MT-II, MT-2 | Label content may not match declared peptide |
Lyophilized peptide powder is generally stored frozen, protected from light and moisture. Tryptophan residues are susceptible to oxidation, and the lactam bridge can hydrolyze under strongly acidic or basic conditions. Solutions prepared for laboratory work degrade faster than dry powder, and repeated freeze-thaw cycles accelerate loss. Common practice is to aliquot solutions before freezing and to avoid alkaline buffers. Reported stability windows vary with concentration, buffer, and temperature, so exact shelf lives are method-specific rather than universal.
Regulatory status differs by country, and in many places supplying the compound for human consumption is unlawful. Vendors frequently label material as intended for research use only, a designation that shifts stated purpose but does not create a legal pathway for personal use. Certificates of analysis accompanying such products vary widely in detail and provenance. Third-party testing exists but is voluntary, and results are rarely linked to a specific lot in a publicly verifiable way.
Identity testing for a synthetic peptide relies on several complementary methods. Reversed-phase high-performance liquid chromatography separates the target from related impurities and reports purity as a percentage of total peak area. Mass spectrometry confirms molecular mass and can reveal deletions or truncations. Amino acid analysis and peptide mapping provide sequence-level confirmation, while counter-ion content and residual solvents are measured separately. A purity figure alone does not establish identity, so a complete dataset combines chromatographic and spectrometric evidence.
Regulatory treatment varies between countries. Several national medicines agencies have classified the peptide as unapproved, and customs authorities in some jurisdictions seize shipments on that basis. A few jurisdictions channel supply through prescription-only frameworks that do not list the substance by name. Because the material circulates mainly through online vendors, composition and purity are rarely verified before sale. Surveys of unapproved peptide products have reported labels that did not match measured content in a substantial fraction of samples.
Melanotan II is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its structure substitutes a lactam bridge between side chains to increase stability relative to the native hormone. The compound is also known by the shorthand MT-II and by several non-proprietary synonyms used in research catalogues. It is not an approved therapeutic product in any major jurisdiction; material sold under this name is typically offered as a laboratory reagent rather than as a medicine.
Activity is attributed to agonism at melanocortin receptors, particularly MC1R and MC4R. Activation of MC1R on melanocytes increases melanin synthesis, which underlies the reported tanning effect. MC4R engagement in the central nervous system is linked to appetite suppression and to effects on sexual arousal reported in early clinical studies. Those studies were small and were not designed to establish efficacy or long-term safety. Receptor selectivity among the melanocortin subtypes is not absolute, which complicates attribution of any effect to a single pathway.
Regulatory treatment varies by jurisdiction and has changed over time. In several countries the peptide is handled as an unapproved prescription medicine, and import or sale for human use is restricted, while elsewhere it falls under poisons or controlled-substance schedules. Enforcement activity against online vendors has been reported in Australia, New Zealand, the United Kingdom and the United States. Scholarly writing discusses melanotan-2 chiefly as an experimental tool and as a case study in unregulated peptide supply, and its precise legal position in any given country should be checked against current national schedules.
Lyophilised melanotan-2 is comparatively robust when kept dry, cold and dark, and a desiccated powder stored at minus twenty degrees Celsius or below is generally expected to retain its chemical integrity for extended periods. In solution the peptide is far less stable, with degradation proceeding through oxidation of tryptophan and histidine residues, hydrolysis adjacent to the lactam bridge, and aggregation at higher concentrations. Repeated freeze-thaw cycling accelerates loss of the parent peak. Working aliquots are therefore prepared once, held cold, and used without letting the stock return to ambient temperature.
Peptides can be synthesised chemically via a range of laboratory methods. Chemical methods typically synthesise peptides in the opposite order (starting at the C-terminus) to biological protein synthesis (starting at the N-terminus).
=== Diseases === P. somniferum is susceptible to several fungal, insect and virus infections including seed borne diseases such as downy mildew and root rot. The use of pesticides in combination to cultural methods have been considered as major control measures for various poppy diseases. The fungal pathogen Peronospora arborescens, the causal agent of downy mildew, occurs preferentially during wet and humid conditions. This oomycete penetrates the roots through oospores and infects the leaves as conidia in a secondary infection. The fungus causes hypertrophy and curvature of the stem and flower stalks. The symptoms are chlorosis and curling of the affected tissues with necrotic spots. The leaf under-surface is covered with a downy mildew coating containing conidiospores that spread the infection further leading to plant damage and death. Another downy mildew species, Peronospora somniferi, produces systemic infections leading to stunting and deformation of poppy plants. Downy mildew can be controlled preventively at the initial stage of seed development through several fungicide applications. Leaf blight caused by the fungus Helminthosporium papaveris is one of the most destructive poppy diseases worldwide. The seed-borne fungus causes root rot in young plants and stunted stems in plants at a higher development stage, where leaf spots appear on the leaves and is being transmitted to capsules and seeds.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Sources: en.wikipedia.org
=== Permian reptiles === With the close of the Carboniferous, the amniotes became the dominant tetrapod fauna. While primitive, terrestrial reptiliomorphs still existed, the synapsid amniotes evolved the first truly terrestrial megafauna (giant animals) in the form of pelycosaurs, such as Edaphosaurus and the carnivorous Dimetrodon. In the mid-Permian period, the climate became drier, resulting in a change of fauna: The pelycosaurs were replaced by the therapsids. Many stem reptile groups continued to flourish throughout the Permian. The herbivorous pareiasaurs were the first lineage of reptiles to reach a large body size, with the largest representatives of the group having a body mass estimated to exceed 1,000 kilograms (2,200 lb). One of the best known early stem-reptiles is Mesosaurus, a genus from the Early Permian of Southern Africa and South America that had returned to water and gained webbed feet, feeding on crustaceans in marine or lagoonal environments. The earliest true diapsids (Neodiapsida), such as Youngina, appeared during the Middle-Late Permian. The Weigeltisauridae, a group of diapsids from the Late Permian, are the oldest known tetrapods to have engaged in flight, using novel rod-like bones extending from the trunk which formed wings to glide between trees.
An independent body (a review board or a committee, institutional, regional, national, or supranational), constituted of medical/scientific professionals and nonmedical/nonscientific members, whose responsibility it is to ensure the protection of the rights, safety, and well-being of human subjects involved in a trial and to provide public assurance of that protection, by, among other things, reviewing and approving/providing favorable opinion on the trial protocol, the suitability of the investigator(s), facilities, and the methods and material to be used in obtaining and documenting informed consent of the trial subjects. The legal status, composition, function, operations, and regulatory requirements pertaining to Independent Ethics Committees may differ among countries, but should allow the Independent Ethics Committee to act in agreement with GCP as described in this guidance. (ICH E6) Indication
=== China and North Korea === In 2019, Galloway defended the authorities' crackdown on protests in Hong Kong. He told China Global Television Network: "These people should know that Hong Kong is China. No country, absolutely no country, will allow an existential threat to emerge on its territory". In 2022, he said there were no internment camps for Uighurs in China. He stated that China had established "re-education centres" to steer terrorists away from the path of extremism. Galloway said, after spending time in North Korea, he "does not agree with the North Korean system" and would not like to live there. He said "there have been achievements in North Korea ... They have a cohesive, pristine actually, innocent culture, a culture not penetrated by globalisation and Western mores". During a period of tension between North and South Korea in 2013, Galloway said "North Korea has no intention to harm any of us. North Korea's problem is with South Korea. ... South Korea exists because America invaded Korea, killed millions of people, divided the country and continues to garrison South Korea with military bases, nuclear weapons, chemical and biological weapon". He blamed the United States for "war mongering" during the crisis and called South Korea its "puppet state".
During Bukele's presidency, El Salvador has hosted a number of international sporting events and one edition of the Miss Universe beauty pageant. Some experts have described El Salvador's hosting of such events as an attempt at sportswashing. Bukele has promoted surfing as part of El Salvador's tourism market. He designated part of El Salvador's Pacific coastline in the La Libertad Department as "Surf City", where the 2021 and 2023 ISA World Surfing Games were hosted. El Salvador also hosted the 2023 Central American and Caribbean Games. At the tournament's opening ceremony, Bukele rebuked critics by saying that he was "not a dictator" and told them to ask everyday Salvadorans what they thought about his "supposed dictatorship". In January 2023, Bukele announced that El Salvador would host the Miss Universe 2023 pageant; the last time El Salvador had hosted Miss Universe was in 1975. At the pageant, Bukele said that Miss Universe had given El Salvador the opportunity to "show the world what we are capable of". On the day of the pageant, 300 members of the Movement for Victims of the State of Emergency held a protest demanding the release of innocent victims of the country's gang crackdown and wanting "Miss Universe to see that Salvadorans are suffering". Some protestors wore sashes reading "Miss Political Prisoners", "Miss Persecution", and "Miss Mass Trials".
Sources: en.wikipedia.org
Tritium, 3H (atomic mass 3.016049281320(81) Da), has one proton and two neutrons in its nucleus (called a triton). It is radioactive, β− decaying into helium-3 with half-life 12.32 years. Traces of 3H occur naturally due to cosmic rays interacting with atmospheric gases. 3H has also been released in nuclear tests. It is used in fusion bombs, as a tracer in isotope geochemistry, and in self-powered lighting devices. The most common way to produce 3H is to bombard a natural isotope of lithium, 6Li, with neutrons in a nuclear reactor. Tritium can be used in chemical and biological labeling experiments as a radioactive tracer. Deuterium–tritium fusion uses 2H and 3H as its main reactants, giving energy through the loss of mass when the two nuclei collide and fuse at high temperatures.
== Adverse effects == Safety and dosing trials showed that the incidence of adverse events in orforglipron-treated participants was 62–89%, mostly from gastrointestinal discomfort (44–70% with orforglipron, 18% with placebo); in patients experiencing adverse events, 96% had mild to moderate GI side effects, while approximately 4% had severe nausea or vomiting. The most common side effects of orforglipon noted in clinical trials were vomiting, diarrhea, nausea, upset stomach, and constipation.
== Special Operations units == The People's Armed Police maintains several Special Operations Units, also known by Western sources as "Special Police units". They were established in Beijing in early 1980s and in 1983 the first of them was transferred to the People's Armed Police as the People's Armed Police Special Police Group. In 1985 the Group became People's Armed Police Special Police School and, in 2002, it became the People's Armed Police Special Police Academy. In 2002, the Snow Wolf Commando Unit, since 2007 Snow Leopard Commando Unit, was established in Beijing as the second special police unit. According to Joel Wuthnow, the Snow Leopard Commando Unit was moved from the Beijing Corps to the 2nd Mobile Corps in 2018. The special operations units are tasked to carry out counter terrorism missions, riot control, anti-hijacking and bomb disposal. Local special operations units receive Explosive Ordinance Disposal (EOD) training, fast roping, counterinsurgency tactics, along with training in hostage rescue and hostage negotiation.
==== Majors and programs ==== Doctoral Communication Sciences and Disorders Audiology Physical Therapy Master's Communication Sciences and Disorders Speech-language Pathology Genetic Counseling Health Administration (in conjunction with the College of Medicine and the Lindner College of Business) Nutrition Sciences Transfusion and Transplantation Services Bachelor's Advanced Medical Imaging Technology Clinical Laboratory Science Clinical Laboratory Science – Distance Learning Communication Sciences and Disorders Dietetics Food and Nutrition Concentration in Exercise Science Concentration in Pre-Medicine Health Information Management – Distance Learning Health Sciences Sports and Biomechanics Concentration Exercise Science Concentration Certificate Clinical Laboratory Science Dietetics School of Social Work
A peptide microarray (also commonly known as peptide chip or peptide epitope microarray) is a collection of peptides displayed on a solid surface, usually a glass or plastic chip. Peptide chips are used by scientists in biology, medicine and pharmacology to study binding properties and functionality and kinetics of protein-protein interactions in general. In basic research, peptide microarrays are often used to profile an enzyme (like kinase, phosphatase, protease, acetyltransferase, histone deacetylase etc.), to map an antibody epitope or to find key residues for protein binding. Practical applications are seromarker discovery, profiling of changing humoral immune responses of individual patients during disease progression, monitoring of therapeutic interventions, patient stratification and development of diagnostic tools and vaccines.
Sources: en.wikipedia.org
Regulatory treatment varies by country. In the United States, the European Union and Australia it is an unapproved drug and its sale is restricted, while some other jurisdictions list it as prescription-only or controlled. The applicable rules depend on the country of import.
Reversed-phase LC-MS/MS is the usual approach for both identification and quantitation. High-resolution mass spectrometry and peptide mapping serve as confirmatory methods. Immunoassays are rarely used alone because of cross-reactivity.
Published testing of seized and purchased samples frequently reports discrepancies between declared and measured peptide content. Counter-ion content and residual solvents add further variation. Independent analysis is the only way to confirm composition.
It is a synthetic cyclic peptide designed as an analog of alpha-melanocyte-stimulating hormone. It acts on melanocortin receptors and is best known from research into pigmentation. It is not an approved pharmaceutical product.